CDN1C_HUMAN P49918
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49918
Recommended name:Cyclin-dependent kinase inhibitor 1C
EC number:
Alternative names:(Cyclin-dependent kinase inhibitor p57) (p57Kip2)
Cleaved into:
GeneID:1028
Gene names (primary ):CDKN1C
Gene names (synonym ):KIP2
Gene names (ORF ):
Length:316
Mass:32177
Sequence:MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR
Tissue specificity:Expressed in the heart, brain, lung, skeletal muscle, kidney, pancreas and testis. Expressed in the eye. High levels are seen in the placenta while low levels are seen in the liver. {ECO:0000269|PubMed:22634751}.
Induction:
Developmental stage:Expressed within a subset of cells in the subcapsular or developing definitive zone of the adrenal gland. {ECO:0000269|PubMed:22634751}.
Protein families:CDI family