PDCD5_HUMAN O14737
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14737
Recommended name：Programmed cell death protein 5
EC number：
Alternative names：(TF-1 cell apoptosis-related protein 19) (Protein TFAR19)
Cleaved into：
GeneID：9141
Gene names (primary )：PDCD5
Gene names (synonym )：TFAR19
Gene names (ORF )：
Length：125
Mass：14285
Sequence：MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY
Tissue specificity：Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
Induction：Activated in cells undergoing apoptosis.
Developmental stage：Expression in fetal tissues is significantly lower than in adult tissues.
Protein families：PDCD5 family