NREP_HUMAN Q16612
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16612
Recommended name：Neuronal regeneration-related protein
EC number：
Alternative names：(Neuronal protein 3.1) (Protein p311)
Cleaved into：
GeneID：9315
Gene names (primary )：NREP
Gene names (synonym )：C5orf13 P311
Gene names (ORF )：
Length：68
Mass：7909
Sequence：MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF
Tissue specificity：Expressed in lung (at protein level). {ECO:0000269|PubMed:16484684}.
Induction：Down-regulated in emphysematous lung compared to normal lung. {ECO:0000269|PubMed:16484684}.
Developmental stage：In embryos of gestational week (gw) 24, detected mostly in the epithelial cells of saccular surfaces. In gw 39, detected in the cells lining the alveolar surfaces as well as in the mesenchyme (at protein level). {ECO:0000269|PubMed:16484684}.
Protein families：