PHB_HUMAN P35232
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35232
Recommended name：Prohibitin
EC number：
Alternative names：
Cleaved into：
GeneID：5245
Gene names (primary )：PHB
Gene names (synonym )：PHB1
Gene names (ORF )：
Length：272
Mass：29804
Sequence：MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Tissue specificity：Widely expressed in different tissues.
Induction：Expression increases approximately 3-fold upon entry into G1 phase compared with other phases of the cell cycle. Also induced following inhibition of mitochondrial protein synthesis by thiamphenicol. {ECO:0000269|PubMed:11302691}.
Developmental stage：Levels of expression in fibroblasts decrease heterogeneously during cellular aging (PubMed:11302691). In CD4(+) T cells, expression increases during polarization towards T-helper Th17, Th1 and Th2 (PubMed:31899195). {ECO:0000269|PubMed:11302691, ECO:0000269|PubMed:31899195}.
Protein families：Prohibitin family