RHF2B_HUMAN P0C7M4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C7M4
Recommended name:Rhox homeobox family member 2B
EC number:
Alternative names:
Cleaved into:
GeneID:727940
Gene names (primary ):RHOXF2B
Gene names (synonym ):
Gene names (ORF ):
Length:288
Mass:31637
Sequence:MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGNLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELECIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNV
Tissue specificity:Expressed in testis, mainly expressed in germ cells, but also detected in somatic cells such as Sertoli cells, Leydig cells and peritubular cells. {ECO:0000269|PubMed:28171660}.
Induction:
Developmental stage:Predominantly expressed in early stage germ cells, type-B spermatogonia and early spermatocytes. {ECO:0000269|PubMed:28171660}.
Protein families:Paired-like homeobox family, PEPP subfamily