CCNE1_MOUSE   Q61457


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61457

Recommended name:G1/S-specific cyclin-E1

EC number:

Alternative names:

Cleaved into:

GeneID:12447

Gene names  (primary ):Ccne1

Gene names  (synonym ):Ccne

Gene names  (ORF ):

Length:408

Mass:46986

Sequence:MPRERDSTDHSNMKEEGGSDLSVRSRKRKANVAVFLQDPDEEIAKIDKTVKSEDSSQPWDDNSACVDPCSFIPTPNKEEDNELEYPRTAFQPRKIRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQAKKAILSEQNRISPPPSVVLTPPPSSKKQSSEQETE

Tissue specificity:Found in adult spleen, and to a lesser extent in adult testis and brain.

Induction:

Developmental stage:

Protein families:Cyclin family, Cyclin E subfamily


   💬 WhatsApp