ARMX6_MOUSE   Q8K3A6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K3A6

Recommended name:Protein ARMCX6

EC number:

Alternative names:

Cleaved into:

GeneID:278097

Gene names  (primary ):Armcx6

Gene names  (synonym ):

Gene names  (ORF ):

Length:301

Mass:33321

Sequence:MGRAREMGWMAAGLMIGAGACYCMYKLTMGRSEGNELEDEEEDEWEDGQDLDEEEADNWFDFTAMARPWSEDGDWDEPGAPGGTEDRRSGGGKANRAHPIKQRPFPYEHKNIWGEQSFKSFTCILDLNKCVSTQRKKRFTKNINAGFSLSPNISKHLASLSVVGNRSPTPHPTVREKALFVPENPNSSLENQGQIKMSIDEVCRETLLCCCKSFLQQAGLSLLISMTVINNMLAKSVSDLKFPLLSKGSGCAEVRGLEELMSLSEKPVLVGEALAAQMLSSFMCLFTRSGSREMLVEAISP

Tissue specificity:Highly expressed in the developing neural tissues, neural crest derivatives and hind limbs. Also widely expressed in the adult nervous tissue, especially in the forebrain, including the cerebral cortex, hippocampus and thalamus. {ECO:0000269|PubMed:22569362}.

Induction:

Developmental stage:

Protein families:Eutherian X-chromosome-specific Armcx family


   💬 WhatsApp