S35E2_MOUSE Q8C811
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C811
Recommended name：Solute carrier family 35 member E2A
EC number：
Alternative names：
Cleaved into：
GeneID：320541
Gene names (primary )：Slc35e2a
Gene names (synonym )：Slc35e2
Gene names (ORF )：
Length：405
Mass：44279
Sequence：MSAAAKSQVPEEAAPGCEEEPKGKTLLTWGSLFGHRSEKIVFTKGDGSPEESLLTVTITETTVIESDLGVWSSRALIYLTLWFFFSFCTLFLNKYILSLLEGEPSMLGAVQMLSTTLIGCVKIFVPCCLYQHKTRLSYPPNFIMTMLFVGLMRFATVVLGLVSLKNVAVSFAETVKSSAPIFTVIMSRMILGEYTGLLVNLSLIPVMGGLALCTATEISFNILGFSAALSTNIMDCLQNVFSKKLLSGDKYRFSAPELQFYTSAAAVALLIPAWTFFMDIPVIGRSGKSFSYSQDIVLLLLTDGALFHLQSVTAYALMGKISPVTFSVASTVKHALSIWLSIIVFGNKITSLSAIGTILVTLGVLLYNKARQYQQETMQSLVTATSRNPEDDTEPLVPQDSRQHH
Tissue specificity：
Induction：
Developmental stage：
Protein families：TPT transporter family, SLC35E subfamily