IGHD_MOUSE P01881
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01881
Recommended name：Ig delta chain C region secreted form
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：
Gene names (synonym )：
Gene names (ORF )：
Length：257
Mass：28368
Sequence：DKKEPDMFLLSECKAPEENEKINLGCLVIGSQPLKISWEPKKSSIVEHVFPSEMRNGNYTMVLQVTVLASELNLNHTCTINKPKRKEKPFKFPESWDSQSSKRVTPTLQAKNHSTEATKAITTKKDIEGAMAPSNLTVNILTTSTHPEMSSWLLCEVSGFFPENIHLMWLGVHSKMKSTNFVTANPTAQPGGTFQTWSVLRLPVALSSSLDTYTCVVEHEASKTKLNASKSLAISGCYHLLPESDGPSRRPDGPALA
Tissue specificity：Cell lines producing IgD contain several mRNA species for Ig delta chains. In plasmacytomas, the secreted form is the major component, and the membrane-bound form is a minor component. In spleen, however, the membrane-bound form is the major component. These two forms differ in their C-terminal segments.
Induction：
Developmental stage：
Protein families：