WBP2_MOUSE   P97765


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97765

Recommended name:WW domain-binding protein 2

EC number:

Alternative names:(WBP-2)

Cleaved into:

GeneID:22378

Gene names  (primary ):Wbp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:261

Mass:28032

Sequence:MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPNGAYGYPYMPSGAYVFPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPSAPATPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ

Tissue specificity:Expressed in the ear and the eye (PubMed:26881968). Isoform 1 is expressed in brain, inner ear and organ of Corti. Isoform 2 is only detected in brain (PubMed:26881968). {ECO:0000269|PubMed:26881968}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp