V1R43_MOUSE   Q8VIC9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VIC9

Recommended name:Vomeronasal type-1 receptor 43

EC number:

Alternative names:(Vomeronasal type-1 receptor A2) (Vomeronasal type-1 receptor A5)

Cleaved into:

GeneID:113847

Gene names  (primary ):Vmn1r43

Gene names  (synonym ):V1ra2 V1ra5

Gene names  (ORF ):

Length:329

Mass:37649

Sequence:MSKILFFSPCSLFSHTMNKNSRLHTNSNIGNTFFSEIGIGITGNSFLLLYHILKFIRGHRPRLTDLPIGLLSLIHLLMLLVAAFIATDIFISRRGWDDIICKFLVYLYRVLRGLSLCTTSMLSVLQAIILSPRSSCLSKFKHISLHHILCAILFLSVLYMLISSQLLVSIIATPNLTTNDLTYVTQSCSILPLSYLVESINSTLLAIREYFLISLMFLSTWYIVALLCMHRKQTQHLQETRLSLKKSPEQSATQTILMLMTFFVLMTIYDNIVSCLRTMLLNDPTSYSIELFMIHIYATVSPFVFMSNEKHIVNFLRSMGKRMINLNLH

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp