UTS2_MOUSE   Q9QZQ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZQ3

Recommended name:Urotensin-2

EC number:

Alternative names:(Urotensin II) (U-II) (UII)

Cleaved into:

GeneID:24111

Gene names  (primary ):Uts2

Gene names  (synonym ):Ucn2

Gene names  (ORF ):

Length:123

Mass:13625

Sequence:MDRVPFCCLLFIGLLNPLLSLPVTDTGERTLQLPVLEEDALRALEELERMALLQTLRQTMGTEAGESPGEAGPSTETPTPRGSMRKAFAGQNSNTVLSRLLARTRKQHKQHGAAPECFWKYCI

Tissue specificity:Brain specific. Predominantly expressed in motoneurons of the brainstem and spinal cord.

Induction:

Developmental stage:

Protein families:Urotensin-2 family


   💬 WhatsApp