UCHL4_MOUSE   P58321


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P58321

Recommended name:Ubiquitin carboxyl-terminal hydrolase isozyme L4

EC number:EC 3.4.19.12

Alternative names:(UCH-L4) (Ubiquitin thioesterase L4)

Cleaved into:

GeneID:93841

Gene names  (primary ):Uchl4

Gene names  (synonym ):

Gene names  (ORF ):

Length:233

Mass:26450

Sequence:MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMESELLSIIPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGTIGLIHAIANNKDKVHFESGSTLKKFLEESVSMSPEERAKYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGWKPFPINHGKTSDETLLEDVIKVCKKFMERDPDELRFNAIALSAA

Tissue specificity:Expressed in various tissues at low level.

Induction:

Developmental stage:

Protein families:Peptidase C12 family


   💬 WhatsApp