TBCE_MOUSE   Q8CIV8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CIV8

Recommended name:Tubulin-specific chaperone E

EC number:

Alternative names:(Tubulin-folding cofactor E)

Cleaved into:

GeneID:70430

Gene names  (primary ):Tbce

Gene names  (synonym ):

Gene names  (ORF ):

Length:524

Mass:59086

Sequence:MSDILPLDVIGRRVEVNGEYATVRFCGAVPPVAGLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLTALKKRYVLEDGPDDDENSCSLKVGSKQVQTIGFEHITKKQSQLRALQDISLWNCAVSHAGEQGRIAEACPNIRVVNLSKNLLSTWDEVVLIAEQLKDLEALDLSENKLQFPSDSPTLTRTFSTLKTLVLNKTGITWTEVLHCAPSWPVLEELYLKSNNISISERPVNVLQKMRLLDLSSNPSIDESQLSLIADLPRLEHLVLSDIGLSSIHFPDAEIGCKTSMFPALKYLIVNDNQISEWSFINELDKLQSLQALSCTRNPLSKADKAEEIIIAKIAQLRTLNRCQILPEERRGAELDYRKAFGNEWRKAGGHPDPDKNRPNAAFLSAHPRYQLLCCKYGAPEDEELKTQQPFMLKKQLLTLKIKCSNQPERQILEKQLPDSMTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRW

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12389029}.

Induction:

Developmental stage:

Protein families:TBCE family


   💬 WhatsApp