PDCD5_MOUSE   P56812


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56812

Recommended name:Programmed cell death protein 5

EC number:

Alternative names:(TF-1 cell apoptosis-related protein 19) (Protein TFAR19)

Cleaved into:

GeneID:56330

Gene names  (primary ):Pdcd5

Gene names  (synonym ):Tfar19

Gene names  (ORF ):

Length:126

Mass:14275

Sequence:MADEELEALRKQRLAELQAKHGDPGDAAQQEAKQREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTEKKTTVKFNRRKVMDSDEDDADY

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:9920759}.

Induction:

Developmental stage:

Protein families:PDCD5 family


   💬 WhatsApp