RHOJ_MOUSE Q9ER71
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ER71
Recommended name:Rho-related GTP-binding protein RhoJ
EC number:
Alternative names:(Tc10-like GTP-binding protein)
Cleaved into:
GeneID:80837
Gene names (primary ):Rhoj
Gene names (synonym ):Arhj Rhoi Rhot Tc10l Tcl
Gene names (ORF ):
Length:214
Mass:23766
Sequence:MSCRERTDSSCGCNGHEENRILKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKGCLGCHGCCAII
Tissue specificity:Highly expressed in heart with moderate levels in lung and liver (PubMed:10967094). Very low levels detected in brain, spleen, skeletal muscle, kidney and testis (PubMed:10967094). {ECO:0000269|PubMed:10967094}.
Induction:
Developmental stage:
Protein families:Small GTPase superfamily, Rho family