SPRE1_MOUSE Q924S8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q924S8
Recommended name：Sprouty-related, EVH1 domain-containing protein 1
EC number：
Alternative names：(Spred-1)
Cleaved into：
GeneID：114715
Gene names (primary )：Spred1
Gene names (synonym )：
Gene names (ORF )：
Length：444
Mass：50664
Sequence：MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFRVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISLGCPASKTEAEGGDDDLQTTEEDTSRSLVKDHFFQQETVVTSEPYRSSDIRPLPFEDLNARRVYLQSQVSQIPFSQQGLDIQSRSMEYVQRQISKECGSLKSQTRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDTDSSVPFSKQDSKKSDYLYHCGDETKLSSLKDSVVFKTQPPSLKFKSKRRKEDGERSRCVYCQERFNHEENARGKCQDAPDPVKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
Tissue specificity：Expressed in brain. Weakly expressed in lung, heart, liver, kidney, intestine, spleen, testis, thymus, colon and ovary. Also expressed in embryonic tissues such as heart, lung, liver and brain. Highly expressed in IL3-dependent hematopoietic cell lines (Ba/F3 and MC/9) and bone marrow-derived mast cells (BMMC). {ECO:0000269|PubMed:11493923, ECO:0000269|PubMed:12646235, ECO:0000269|PubMed:15465815, ECO:0000269|PubMed:15580519}.
Induction：
Developmental stage：
Protein families：