RGS16_MOUSE P97428
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97428
Recommended name：Regulator of G-protein signaling 16
EC number：
Alternative names：(RGS16) (A28-RGS14P) (Retinal-specific RGS) (RGS-r) (Retinally abundant regulator of G-protein signaling)
Cleaved into：
GeneID：19734
Gene names (primary )：Rgs16
Gene names (synonym )：Rgsr
Gene names (ORF )：
Length：201
Mass：22691
Sequence：MCRTLATFPNTCLERAKEFKTRLGIFLHKSELSSDTGGISKFEWASKHNKERSFSEDVLGWRESFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASATSTSAPSGSPAEPSHT
Tissue specificity：Retinal; also predominantly expressed in the liver and pituitary.
Induction：
Developmental stage：
Protein families：