CPLN2_MOUSE   A2A825


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2A825

Recommended name:Ciliogenesis and planar polarity effector 2

EC number:

Alternative names:(REM2- and Rab-like small GTPase 1)

Cleaved into:

GeneID:76166

Gene names  (primary ):Cplane2

Gene names  (synonym ):Gm723 Rsg1

Gene names  (ORF ):

Length:258

Mass:28422

Sequence:MARPPMHGSVIVPDWHETVEGKEYLACILRKNRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVPIVHHETTGIQTTVVFWPAKLKASDCVVMFRFEFWDCGESALKKFDHMLPACKENADAFLFLFSFTDRASFEDLPGQLTRVAGEAPGLVKIVIGSKFDQYMHTDVPARDLTAFRQAWELPLFRVKSVPGRRLADGRTLDGRAGLADTAHVLNGLAEQLWHQDQVAAGLLPSSPESAPG

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rab family


   💬 WhatsApp