S115A_MOUSE   Q6S5I3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6S5I3

Recommended name:Protein S100-A15A

EC number:

Alternative names:(Protein S100-A7A) (S100 calcium-binding protein A15A) (S100 calcium-binding protein A7A)

Cleaved into:

GeneID:381493

Gene names  (primary ):S100a15a

Gene names  (synonym ):S100a15 S100a7 S100a7a

Gene names  (ORF ):

Length:108

Mass:12870

Sequence:MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY

Tissue specificity:

Induction:

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp