PCP2_MOUSE   P12660


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P12660

Recommended name:Purkinje cell protein 2

EC number:

Alternative names:(Protein PCD-5) (Purkinje cell-specific protein L7)

Cleaved into:

GeneID:18545

Gene names  (primary ):Pcp2

Gene names  (synonym ):Pcp-2

Gene names  (ORF ):

Length:120

Mass:13054

Sequence:MAGSPDQEGFFNLLTHVQGDRMEEQRCSLQAGPGQNPESQGGPAPEMDNLMDMLVNTQGRRMDDQRVTVNSLPGFQPIGPKDGMQKRPGTLSPQPLLTPQDPAALSFRRNSSPQPQTQAP

Tissue specificity:Cerebellum (Purkinje cells) and retinal bipolar neurons.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp