CD99_MOUSE Q8VCN6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VCN6
Recommended name：CD99 antigen
EC number：
Alternative names：(Paired immunoglobin-like type 2 receptor-ligand) (PILR-L) (CD antigen CD99)
Cleaved into：
GeneID：673094
Gene names (primary )：Cd99
Gene names (synonym )：Pilrl
Gene names (ORF )：
Length：175
Mass：16783
Sequence：MARAAMEAAATVVLALALLGAAARGAASDDFNLGDALEDPNMKPTPKAPTPKKPSGGFDLEDALPGGGGGGAGEKPGNRPQPDPKPPRPHGDSGGISDSDLADAAGQGGGGAGRRGSGDEGGHGGAGGAEPEGTPQGLVPGVVAAVVAAVAGAVSSFVAYQRRRLCFREGGSAPV
Tissue specificity：Widely expressed with high levels in lung, spleen, thymus, liver and spinal chord. Expressed on leukocytes and endothelial cell contacts. Detected in a wide range of T-cells, including CD4-/CD8- and CD4+/CD8+ thymocytes. Expression is much lower in peripheral T-cells than in thymocytes. {ECO:0000269|PubMed:14970179, ECO:0000269|PubMed:15280198}.
Induction：
Developmental stage：
Protein families：CD99 family