HMR1_MOUSE   Q8HWB0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8HWB0

Recommended name:Major histocompatibility complex class I-related gene protein

EC number:

Alternative names:(MHC class I-related gene protein) (Class I histocompatibility antigen-like protein)

Cleaved into:

GeneID:15064

Gene names  (primary ):Mr1

Gene names  (synonym ):Mr1a

Gene names  (ORF ):

Length:341

Mass:39391

Sequence:MMLLLPLLAVFLVKRSHTRTHSLRYFRLAVSDPGPVVPEFISVGYVDSHPITTYDSVTRQKEPKAPWMAENLAPDHWERYTQLLRGWQQTFKAELRHLQRHYNHSGLHTYQRMIGCELLEDGSTTGFLQYAYDGQDFIIFNKDTLSWLAMDYVAHITKQAWEANLHELQYQKNWLEEECIAWLKRFLEYGRDTLERTEHPVVRTTRKETFPGITTFFCRAHGFYPPEISMTWMKNGEEIAQEVDYGGVLPSGDGTYQTWLSVNLDPQSNDVYSCHVEHCGRQMVLEAPRESGDILRVSTISGTTILIIALAGVGVLIWRRSQELKEVMYQPTQVNEGSSPS

Tissue specificity:Highly expressed thymus. Expressed in liver, kidney, spleen, heart, brain, lung, skeletal muscle and testis. {ECO:0000269|PubMed:9325151, ECO:0000269|PubMed:9780177}.

Induction:

Developmental stage:

Protein families:MHC class I family


   💬 WhatsApp