CD83_MOUSE O88324
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88324
Recommended name：CD83 antigen
EC number：
Alternative names：(mCD83) (CD antigen CD83)
Cleaved into：
GeneID：12522
Gene names (primary )：Cd83
Gene names (synonym )：
Gene names (ORF )：
Length：196
Mass：21313
Sequence：MSQGLQLLFLGCACSLAPAMAMREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV
Tissue specificity：Abundantly expressed in spleen and brain, but is also detected in most tissues analyzed. {ECO:0000269|PubMed:9799334}.
Induction：
Developmental stage：
Protein families：