VNS2_MOUSE   Q62472


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62472

Recommended name:Vomeronasal secretory protein 2

EC number:

Alternative names:(Lipocalin-4) (Vomeronasal secretory protein II) (VNSP II)

Cleaved into:

GeneID:16821

Gene names  (primary ):Lcn4

Gene names  (synonym ):

Gene names  (ORF ):

Length:185

Mass:21399

Sequence:MKSLLLTVTLSSLVATLQTYDDLPFISEEDKLSGVWFIKATVSQRREVEGETLVAFPIKFTCPEEGTLELRHTLASKGECINVGIRLQRTEEPGQYSAFWGHTLFYIYDLPVKDHYIIYCESHPFQKISQFGYLIGKYPEENQDTLEVFKEFIQHKGFLQEKIGVPEQRDRCIPIHDSAHQDHKC

Tissue specificity:Specifically expressed in vomeronasal and posterior glands of the nasal septum, the ducts of which open into the lumen of the vomeronasal organ.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp