INSL3_MOUSE   O09107


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O09107

Recommended name:Insulin-like 3

EC number:

Alternative names:(Leydig insulin-like peptide) (Ley-I-L) (Relaxin-like factor)

Cleaved into:Insulin-like 3 B chain; Insulin-like 3 A chain

GeneID:

Gene names  (primary ):Insl3

Gene names  (synonym ):Rlf

Gene names  (ORF ):

Length:122

Mass:13586

Sequence:MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPRWSPEATQPVETRDRELLQWLEQRHLLHALVADVDPALDPQLPRQASQRQRRSAATNAVHRCCLTGCTQQDLLGLCPH

Tissue specificity:Expressed exclusively in Leydig cells of the testis.

Induction:

Developmental stage:

Protein families:Insulin family


   💬 WhatsApp