TBCEL_MOUSE   Q8C5W3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C5W3

Recommended name:Tubulin-specific chaperone cofactor E-like protein

EC number:

Alternative names:(Leucine-rich repeat-containing protein 35)

Cleaved into:

GeneID:272589

Gene names  (primary ):Tbcel

Gene names  (synonym ):Lrrc35

Gene names  (ORF ):

Length:424

Mass:48032

Sequence:MDQPSGRSFMQVLCEKYSPENFPYRRGPGVGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSNPLSLSVLERTCAGSFSGVRKLVLNNSKASWETVHTILQELPELEELFLCLNDYETVSCPSVCCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPADSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSSMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIFVESKTK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp