OREX_MOUSE   O55241


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O55241

Recommended name:Orexin

EC number:

Alternative names:(Hypocretin) (Hcrt)

Cleaved into:Orexin-A (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)

GeneID:15171

Gene names  (primary ):Hcrt

Gene names  (synonym ):Ox Ppox

Gene names  (ORF ):

Length:130

Mass:13503

Sequence:MNFPSTKVPWAAVTLLLLLLLPPALLSLGVDAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRPGPPGLQGRLQRLLQANGNHAAGILTMGRRAGAELEPHPCSGRGCPTVTTTALAPRGGSGV

Tissue specificity:Restricted to neuronal cell bodies of the dorsal and lateral hypothalamus.

Induction:

Developmental stage:

Protein families:Orexin family


   💬 WhatsApp