K1H2_MOUSE Q62168
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62168
Recommended name:Keratin, type I cuticular Ha2
EC number:
Alternative names:(Hair keratin, type I Ha2) (Keratin-32) (K32)
Cleaved into:
GeneID:16670
Gene names (primary ):Krt32
Gene names (synonym ):Hka2 Krt1-2 Krtha2
Gene names (ORF ):
Length:407
Mass:46422
Sequence:MPSVCMPTTYRPASCLSKTYLSSSCQPSNRRPTGCISSSMGTYGLFCEGAFNGNEKETMQVLNDRLANYLEKVRQLEKENAELEGKIQDVYQGQVLTMCPDYQSYFQTIEELQQKVLCTKAENARMIVHIDNAKLAADDFRTKYETELALRQLVEADTNGLRRILDELTLNKADLEAQVESLKEELLCLKRNHEEEVGVLRQQLGDRLNIEVDAAPPVDLTRMLEEMRCQYETMVETNHRDVEEWFNMQMEELNKQVATSSEQLQSYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLGETEGRFTSQLSQMQCMITNVESQLSDIRCDLERQNQEYKVLLDVKARLECEIDTYRGLLESEDSKLPCNPCSTPSCQPCAPSPGVSRTVCVPHTVCVPCSPCLQTRY
Tissue specificity:Cuticle of the hair shaft.
Induction:
Developmental stage:
Protein families:Intermediate filament family