H2B1M_MOUSE P10854
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10854
Recommended name：Histone H2B type 1-M
EC number：
Alternative names：(H2B 291B)
Cleaved into：
GeneID：319186
Gene names (primary )：H2bc14
Gene names (synonym )：Hist1h2bm
Gene names (ORF )：
Length：126
Mass：13936
Sequence：MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Tissue specificity：
Induction：
Developmental stage：
Protein families：Histone H2B family