GRP_MOUSE Q8R1I2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R1I2
Recommended name:Gastrin-releasing peptide
EC number:
Alternative names:(GRP)
Cleaved into:Neuromedin-C (GRP-10)
GeneID:225642
Gene names (primary ):Grp
Gene names (synonym ):
Gene names (ORF ):
Length:146
Mass:15659
Sequence:MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDESPSLYAADRDGLKEQLRGYVRWEEAARDLLDLLEAAGNQSHQPPQHPPLSLQPTWDPEDGSYFNDVQTAKLVDSLLQVLKEKGGTAS
Tissue specificity:Detected in the suprachiasmatic nucleus in the hypothalamus (PubMed:28280205). Detected in peptidergic dorsal root ganglion neurons (at protein level) (PubMed:17653196). Highly expressed both in the lateral nucleus of the amygdala, and in regions sending synaptic projections to the lateral nucleus (PubMed:12526815). {ECO:0000269|PubMed:12526815, ECO:0000269|PubMed:17653196, ECO:0000269|PubMed:28280205}.
Induction:
Developmental stage:
Protein families:Bombesin/neuromedin-B/ranatensin family