T2AG_MOUSE Q80ZM7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80ZM7
Recommended name：Transcription initiation factor IIA subunit 2
EC number：
Alternative names：(General transcription factor IIA subunit 2) (Transcription initiation factor IIA gamma chain) (TFIIA-gamma)
Cleaved into：
GeneID：235459
Gene names (primary )：Gtf2a2
Gene names (synonym )：
Gene names (ORF )：
Length：109
Mass：12473
Sequence：MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Tissue specificity：
Induction：
Developmental stage：
Protein families：TFIIA subunit 2 family