FPR2_MOUSE O88536
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88536
Recommended name：Formyl peptide receptor 2
EC number：
Alternative names：(Formylpeptide receptor-related sequence 2) (Lipoxin A4 receptor-like protein) (N-formylpeptide receptor-like 2)
Cleaved into：
GeneID：14289
Gene names (primary )：Fpr2
Gene names (synonym )：Fpr-rs2
Gene names (ORF )：
Length：351
Mass：39422
Sequence：MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
Tissue specificity：Primarily expressed in neutrophils. Not detected in vomeronasal neurons. {ECO:0000269|PubMed:10477558, ECO:0000269|PubMed:15879124, ECO:0000269|PubMed:17237393, ECO:0000269|PubMed:19387439, ECO:0000269|PubMed:19497865}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family