FPRS1_MOUSE   O08790


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O08790

Recommended name:Formyl peptide receptor-related sequence 1

EC number:

Alternative names:(FMLP-related receptor I) (FMLP-R-I) (Formyl peptide receptor related sequence 1) (Formyl peptide receptor-like 1) (Lipoxin A4 receptor) (LXA4 receptor) (N-formyl peptide receptor 2) (N-formyl peptide receptor 3)

Cleaved into:

GeneID:14294

Gene names  (primary ):Fpr-s1

Gene names  (synonym ):Fpr2 Fpr3 Fprl1 Lxa4r

Gene names  (ORF ):

Length:351

Mass:39523

Sequence:METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVTTIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIALDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSFVSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPFRVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPILYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI

Tissue specificity:Expressed exclusively in vomeronasal neurons (PubMed:19387439 and PubMed:19497865). Expressed in 0.6 % of a subset of sensory neurons located in the basal layer of the vomeronasal organ. Each neuron appears to express only one receptor gene. Expressed mostly in neutrophils, followed by spleen and lung and expressed at very low levels in heart and liver (PubMed:19387439). {ECO:0000269|PubMed:19387439, ECO:0000269|PubMed:19497865, ECO:0000269|PubMed:9151906, ECO:0000269|PubMed:9722950}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp