CEP20_MOUSE   Q9CZS3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CZS3

Recommended name:Centrosomal protein 20

EC number:

Alternative names:(FGFR1OP N-terminal-like protein) (FOP-related protein of 20 kDa) (LisH domain-containing protein FOPNL)

Cleaved into:

GeneID:66086

Gene names  (primary ):Cep20

Gene names  (synonym ):Fopnl For20

Gene names  (ORF ):

Length:174

Mass:19642

Sequence:MATVTELKAVLKDTLEKRGVLGHLKARIRAEVFNALDDDREPRPSLSHENLLINELIREYLEFNKYKYTASVLIAESGQPVVPLDRQFLIRELNAFEESKDNSIPLLYGILAHFLRGPPDGAQNVLLTESTLHPATKHLSWKPSRRPDDDHVRKDTGPRTTTEELPAAAQAVSR

Tissue specificity:

Induction:

Developmental stage:

Protein families:CEP43 family


   💬 WhatsApp