WFD18_MOUSE P62810
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62810
Recommended name:WAP four-disulfide core domain protein 18
EC number:
Alternative names:(Extracellular peptidase inhibitor) (Protein WDNM1)
Cleaved into:
GeneID:14038
Gene names (primary ):Wfdc18
Gene names (synonym ):Expi Wdnm1
Gene names (ORF ):
Length:74
Mass:7787
Sequence:MKTATVFVLVALIFMTMTTAWALSNPKEKPGACPKPPPRSFGTCDERCTGDGSCSGNMKCCSNGCGHACKPPVF
Tissue specificity:
Induction:
Developmental stage:
Protein families: