EHF_MOUSE   O70273


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70273

Recommended name:ETS homologous factor

EC number:

Alternative names:(ETS domain-containing transcription factor)

Cleaved into:

GeneID:13661

Gene names  (primary ):Ehf

Gene names  (synonym ):

Gene names  (ORF ):

Length:300

Mass:34903

Sequence:MILEGSGVMNLNPANNLLHQQPAWTDSYPTCNVSSGFFGSQWHEIHPQYWTKYQVWEWLQHLLDTNQLDASCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSDLFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQISMTTSSHLPVAESPDMKKEQDHPVKSHTKKHNPRGTHLWEFIRDILLSPDKNPGLIKWEDRSEGIFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN

Tissue specificity:Highly expressed in kidney and lung, weakly in skeletal muscle, heart, and liver, and not detected in brain, spleen or testis. {ECO:0000269|PubMed:9600089}.

Induction:

Developmental stage:

Protein families:ETS family


   💬 WhatsApp