FLOT2_MOUSE Q60634
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60634
Recommended name：Flotillin-2
EC number：
Alternative names：(Epidermal surface antigen) (ESA) (Membrane component chromosome 17 surface marker 1 homolog)
Cleaved into：
GeneID：14252
Gene names (primary )：Flot2
Gene names (synonym )：Esa1 M17s1
Gene names (ORF )：
Length：428
Mass：47038
Sequence：MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKNATGAQV
Tissue specificity：Expressed in many tissues, including suprabasal epidermis, hair follicles, heart, lung, thymus, spleen, liver, kidney and brain. Not expressed in skeletal muscle.
Induction：
Developmental stage：
Protein families：Band 7/mec-2 family, Flotillin subfamily