EVI2A_MOUSE   P20934


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P20934

Recommended name:Protein EVI2A

EC number:

Alternative names:(Ecotropic viral integration site 2A protein) (EVI-2A)

Cleaved into:

GeneID:14017

Gene names  (primary ):Evi2a

Gene names  (synonym ):Evi-2 Evi-2a Evi2

Gene names  (ORF ):

Length:223

Mass:24087

Sequence:MEHKGQYLHLVFLMTTVWASSSSGTRPNYTHLWASSVTASGSSNQNGSSRHPSDNNTNLVTPAVGHKVSATDKPASSPPVPLASTSTLKSSTPHAFRNSSPTAEIKSQGETFKKEVCEENTSNTAMLICLIVIAVLFLICTFLFLSTVVLANKVSSLKRSKQVGKRQPRSNGDFLASSGLWTAESDTWKRAKELTGSNLLLQSPGVLTAARERKHEEGTEKLN

Tissue specificity:

Induction:

Developmental stage:

Protein families:EVI2A family


   💬 WhatsApp