SPT4B_MOUSE Q9Z199
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z199
Recommended name：Transcription elongation factor SPT4-B
EC number：
Alternative names：(DRB sensitivity-inducing factor small subunit 2) (DSIF small subunit 2) (Transcription elongation factor SPT4 2)
Cleaved into：
GeneID：100041294
Gene names (primary )：Supt4h1b
Gene names (synonym )：Gm3258 Supt4b Supt4h2
Gene names (ORF )：
Length：117
Mass：13194
Sequence：MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGINAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Tissue specificity：Expressed in brain, heart and liver. {ECO:0000269|PubMed:9776760}.
Induction：
Developmental stage：
Protein families：SPT4 family