TIM14_MOUSE   Q9CQV7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQV7

Recommended name:Mitochondrial import inner membrane translocase subunit TIM14

EC number:

Alternative names:(DnaJ homolog subfamily C member 19)

Cleaved into:

GeneID:67713

Gene names  (primary ):Dnajc19

Gene names  (synonym ):Tim14 Timm14

Gene names  (ORF ):

Length:116

Mass:12437

Sequence:MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAFGGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK

Tissue specificity:

Induction:

Developmental stage:

Protein families:TIM14 family


   💬 WhatsApp