AP4A_MOUSE   P56380


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P56380

Recommended name:Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]

EC number:EC 3.6.1.17

Alternative names:(Diadenosine 5',5'''-P1,P4-tetraphosphate asymmetrical hydrolase) (Ap4A hydrolase) (Ap4Aase) (Diadenosine tetraphosphatase) (Nucleoside diphosphate-linked moiety X motif 2) (Nudix motif 2)

Cleaved into:

GeneID:66401

Gene names  (primary ):Nudt2

Gene names  (synonym ):Apah1

Gene names  (ORF ):

Length:147

Mass:16989

Sequence:MALRACGLIIFRRHLIPKMDNSTIEFLLLQASDGIHHWTPPKGHVDPGENDLETALRETREETGIEASQLTIIEGFRRELNYVARQKPKTVIYWLAEVKDYNVEIRLSQEHQAYRWLGLEEACQLAQFKEMKATLQEGHQFLCSTPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Nudix hydrolase family


   💬 WhatsApp