DNAS1_MOUSE P49183
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49183
Recommended name:Deoxyribonuclease-1
EC number:EC 3.1.21.1
Alternative names:(Deoxyribonuclease I) (DNase I)
Cleaved into:
GeneID:13419
Gene names (primary ):Dnase1
Gene names (synonym ):Dnl1
Gene names (ORF ):
Length:284
Mass:32027
Sequence:MRYTGLMGTLLTLVNLLQLAGTLRIAAFNIRTFGETKMSNATLSVYFVKILSRYDIAVIQEVRDSHLVAVGKLLDELNRDKPDTYRYVVSEPLGRKSYKEQYLFVYRPDQVSILDSYQYDDGCEPCGNDTFSREPAIVKFFSPYTEVQEFAIVPLHAAPTEAVSEIDALYDVYLDVWQKWGLEDIMFMGDFNAGCSYVTSSQWSSIRLRTSPIFQWLIPDSADTTVTSTHCAYDRIVVAGALLQAAVVPNSAVPFDFQAEYGLSNQLAEAISDHYPVEVTLRKI
Tissue specificity:Highly expressed in the parotid and submandibular gland as well as in the kidney and duodenum (at protein level) (PubMed:15015938). Expressed at intermediate level in the ileum, mesenterial lymph nodes, liver, ventral prostate, epididymis, ovary and stomach (at protein level) (PubMed:15015938). Expressed at low level in the sublingual, preputial, coagulation and pituitary gland (at protein level) (PubMed:15015938). Also present in the lachrymal and thyroid glands, striated muscle, intestine, the urinary bladder and the eye (PubMed:7857306, PubMed:9192086, PubMed:15015938). {ECO:0000269|PubMed:15015938, ECO:0000269|PubMed:7857306, ECO:0000269|PubMed:9192086}.
Induction:
Developmental stage:
Protein families:DNase I family