COX8B_MOUSE   P48772


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48772

Recommended name:Cytochrome c oxidase subunit 8B, mitochondrial

EC number:

Alternative names:(Cytochrome c oxidase polypeptide VIII-heart) (Cytochrome c oxidase subunit 8-1) (Cytochrome c oxidase subunit 8H)

Cleaved into:

GeneID:12869

Gene names  (primary ):Cox8b

Gene names  (synonym ):Cox8h

Gene names  (ORF ):

Length:70

Mass:7332

Sequence:MPRLPPILRLLQAPAKFTVVPKAHVSAKPAKTPTSAVEQAVGISAIVVGFMVPAGWVLAHLESYKKSSAA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome c oxidase VIII family


   💬 WhatsApp