C1GLC_MOUSE   Q9JMG2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JMG2

Recommended name:C1GALT1-specific chaperone 1

EC number:

Alternative names:(Core 1 beta1,3-galactosyltransferase 2) (C1Gal-T2) (C1GalT2) (Core 1 beta3-Gal-T2) (mC1Gal-T2) (Core 1 beta3-galactosyltransferase-specific molecular chaperone)

Cleaved into:

GeneID:59048

Gene names  (primary ):C1galt1c1

Gene names  (synonym ):Cosmc

Gene names  (ORF ):

Length:316

Mass:36067

Sequence:MLSESSSFLKGVMLGSIFCALITMLGHIRIGNRMHHHEHHHLQAPNKDDISKISEAERMELSKSFRVYCIVLVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQPFYLGHTVKSGDLEYVSVDGGIVLSIESMKRLNSLLSVPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLFIKEAMTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDALVFLPPNGSEND

Tissue specificity:

Induction:

Developmental stage:

Protein families:Glycosyltransferase 31 family, Beta3-Gal-T subfamily


   💬 WhatsApp