CDKA1_MOUSE   O35207


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35207

Recommended name:Cyclin-dependent kinase 2-associated protein 1

EC number:

Alternative names:(CDK2-associated protein 1) (Deleted in oral cancer 1) (DOC-1) (Putative oral cancer suppressor)

Cleaved into:

GeneID:13445

Gene names  (primary ):Cdk2ap1

Gene names  (synonym ):Cdkap1 Doc1

Gene names  (ORF ):

Length:114

Mass:12354

Sequence:MSYKPNLTAHMPAAALNAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS

Tissue specificity:

Induction:

Developmental stage:

Protein families:CDK2AP family


   💬 WhatsApp