CNN2_MOUSE   Q08093


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q08093

Recommended name:Calponin-2

EC number:

Alternative names:(Calponin H2, smooth muscle) (Neutral calponin)

Cleaved into:

GeneID:12798

Gene names  (primary ):Cnn2

Gene names  (synonym ):

Gene names  (ORF ):

Length:305

Mass:33156

Sequence:MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRSWIEGLTGLSIGPDFQKGLKDGVILCTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRHLYDPKNHILPPMDHCTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGSAADGAPAGDGQGEAPEYLAYCQEEAGY

Tissue specificity:Smooth muscle, and tissues containing significant amounts of smooth muscle.

Induction:

Developmental stage:

Protein families:Calponin family


   💬 WhatsApp