TR13C_MOUSE   Q9D8D0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D8D0

Recommended name:Tumor necrosis factor receptor superfamily member 13C

EC number:

Alternative names:(B-cell maturation defect) (B-cell-activating factor receptor) (BAFF receptor) (BAFF-R) (BLyS receptor 3) (CD antigen CD268)

Cleaved into:

GeneID:72049

Gene names  (primary ):Tnfrsf13c

Gene names  (synonym ):Baffr Bcmd Br3

Gene names  (ORF ):

Length:175

Mass:18798

Sequence:MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPDTGHTSSLEPGTALQPQEGSALRPDVALLVGAPALLGLILALTLVGLVSLVSWRWRQQLRTASPDTSEGVQQESLENVFVPSSETPHASAPTWPPLKEDADSALPRHSVPVPATELGSTELVTTKTAGPEQ

Tissue specificity:Highly expressed in spleen and testis; detected at lower levels in lung and thymus.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp