RHG15_MOUSE   Q811M1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q811M1

Recommended name:Rho GTPase-activating protein 15

EC number:

Alternative names:(ArhGAP15) (Rho-type GTPase-activating protein 15)

Cleaved into:

GeneID:76117

Gene names  (primary ):Arhgap15

Gene names  (synonym ):

Gene names  (ORF ):

Length:481

Mass:55339

Sequence:MEKRTSCSVQTSTNCDNSLEILNSAHQATGAVQMRIKNANSHQDRQSQTKSMILTDAGKVTEPISRHRRNHSQHVLKDVIPPLEHPMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSGRKIEFYKDSKQQALPNMKTRHNVESVDLCGAHIEWAKEKSSRKSVFQITTVSGNEFLLQSDIDFLILDWFQAIKNAIDRLPKNPSCGSLELFNLQRSSSSELPSHCHIDRKEQKPEHRKSFMFRLHHSASDTSDKNRVKSRLKKFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFRELSEPLFPYSFFERFVEAIKKQDSNEKIETMRSLVKRLPPPNHDTMKILFRHLTKIVAKASQNLMSTQSLGIVFGPTLLRAENESGNVAVHMVYQNQIAEFMLTEYDKIFSSEED

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp