GRB2_MOUSE   Q60631


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q60631

Recommended name:Growth factor receptor-bound protein 2

EC number:

Alternative names:(Adapter protein GRB2) (SH2/SH3 adapter GRB2)

Cleaved into:

GeneID:14784

Gene names  (primary ):Grb2

Gene names  (synonym ):

Gene names  (ORF ):

Length:217

Mass:25238

Sequence:MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV

Tissue specificity:Expressed in macrophages. {ECO:0000269|PubMed:28098138}.

Induction:

Developmental stage:

Protein families:GRB2/sem-5/DRK family


   💬 WhatsApp